PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015874093.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family Dof
Protein Properties Length: 357aa    MW: 37986.4 Da    PI: 10.1155
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015874093.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1252.4e-3977137262
          zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                     +e+alkcprC+stntkfCy+nnysl+qPr+fCk+CrryWt+GGalrnvPvGgg+r+nkks+
  XP_015874093.1  77 PEAALKCPRCESTNTKFCYFNNYSLTQPRHFCKTCRRYWTRGGALRNVPVGGGCRRNKKSK 137
                     67899*****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-3164130IPR003851Zinc finger, Dof-type
PfamPF027011.0E-3280135IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.46981135IPR003851Zinc finger, Dof-type
PROSITE patternPS01361083119IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 357 aa     Download sequence    Send to blast
MVFSSIPVYL DPPNWHQQQN HHRLGSGGNS SETPQLPPLP PPPPPHVGVG GGSGGGIGSI  60
RPGSMADRAR LAKLPQPEAA LKCPRCESTN TKFCYFNNYS LTQPRHFCKT CRRYWTRGGA  120
LRNVPVGGGC RRNKKSKSNN RSKSPVSTER PMGGSSSTNL MINPSGSDVV SRLLPPPQQN  180
QSSSFMLSIQ NHLSRFAGGG GGGGNLGLNF SEIQVPGDIG FPMGGNSGGN NVMLPGGEAD  240
QWRLQQFPPL MGNGFDSSSS SGLYPFQVGT EGVVEPVLPP MVGESQLIRN FSSSRVSQIN  300
NNPPVKREDN HQGLNLSSSR PTLNAISENN NQFWGGSPWS TDISGGLNSS SSSSHLL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015874093.10.0PREDICTED: dof zinc finger protein DOF2.4 isoform X1
TrEMBLW9S2593e-98W9S259_9R
STRINGPOPTR_0001s24540.13e-85(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF65634143
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37590.12e-43DNA binding with one finger 2.4